Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ACADVL Rabbit Polyclonal Antibody

SKU: orb330756

Description

ACADVL Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ACADVL. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ACADVL
TargetACADVL
Protein SequenceSynthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
Molecular Weight64kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ACAD6 antibody, anti LCACD antibody, anti VLCAD antibody

Similar Products

  • ACADVL Rabbit Polyclonal Antibody [orb381025]

    FC,  ICC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ACADVL Antibody [orb1244526]

    ELISA,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ACADVL Rabbit Polyclonal Antibody [orb330757]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • ACADVL Rabbit Polyclonal Antibody (Biotin) [orb458401]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit

    Rat

    Rabbit

    Polyclonal

    Biotin

  • ACADVL Rabbit Polyclonal Antibody [orb624429]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ACADVL Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. ACADVL is supported by BioGPS gene expression data to be expressed in HeLa.

ACADVL Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

ACADVL Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

ACADVL Rabbit Polyclonal Antibody

Lanes: 1: Normal controls Normal enzyme expression, 2: Normal controls Normal enzyme expression, 3: Positive mutants Defective enzyme expression, 4: Positive mutants Defective enzyme expression, 5: Positive mutants Defective enzyme expression, Primary Antibody dilution: 1:2000, Secondary Antibody: Secondary Antibody dilution: 1:1000, Gene Name: ACADVL.

ACADVL Rabbit Polyclonal Antibody

Rabbit Anti-ACADVL Antibody, Catalog Number: orb330756, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies of pinealocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

ACADVL Rabbit Polyclonal Antibody

WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate, ACADVL is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ACADVL Rabbit Polyclonal Antibody (orb330756)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 610.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry