Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

AGER Rabbit Polyclonal Antibody

SKU: orb578077

Description

AGER Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of AGER. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human AGER. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AGER
TargetAGER
Protein SequenceSynthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT
Molecular Weight36kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

RAGE, sRAGE, SCARJ1

Similar Products

  • RAGE Rabbit Polyclonal Antibody [orb10063]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Human, Mouse

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RAGE Rabbit Polyclonal Antibody [orb155611]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Human, Porcine

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RAGE/AGER Rabbit Polyclonal Antibody [orb1098124]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RAGE/AGER Rabbit Polyclonal Antibody [orb308764]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • RAGE Rabbit Polyclonal Antibody (FITC) [orb15071]

    FC,  IF

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

AGER Rabbit Polyclonal Antibody

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

AGER Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

AGER Rabbit Polyclonal Antibody

Lane 1: 10 ug of hRAGE HEK-293 lysate, Lane 2: 10 ug of mRAGE HEK-293 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:2500, Gene Name: AGER.

AGER Rabbit Polyclonal Antibody

WB Suggested Anti-AGER Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_751947

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

AGER Rabbit Polyclonal Antibody (orb578077)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry