Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ALDH3A2 Rabbit Polyclonal Antibody

SKU: orb330379

Description

ALDH3A2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ALDH3A2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human ALDH3A2. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ALDH3A2
TargetALDH3A2
Protein SequenceSynthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR
Molecular Weight58kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ALDH10 antibody, anti DKFZp686E23276 antibody, anti FALDH antibody, anti FLJ20851 antibody, anti SLS antibody

Similar Products

  • ALDH3A2 Antibody [orb521878]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • ALDH3A2 Rabbit Polyclonal Antibody [orb624624]

    ELISA,  FC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ALDH3A2 Rabbit Polyclonal Antibody [orb330380]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • ALDH3A2 Rabbit Polyclonal Antibody [orb371716]

    IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ALDH3A2 Antibody [orb521877]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ALDH3A2 Rabbit Polyclonal Antibody

WB Suggested Anti-ALDH3A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: NCI-H226 cell lysate.

ALDH3A2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

ALDH3A2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

ALDH3A2 Rabbit Polyclonal Antibody

Rabbit Anti-ALDH3A2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adult Adrenal, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec.

ALDH3A2 Rabbit Polyclonal Antibody

WB Suggested Anti-ALDH3A2 Antibody, Positive Control: Lane 1: 30 ug human primary hepatocytes, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ALDH3A2 Rabbit Polyclonal Antibody (orb330379)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry