Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ANXA1 Rabbit Polyclonal Antibody

SKU: orb576008

Description

ANXA1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ANXA1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Guinea pig, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Guinea pig, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ANXA1
TargetANXA1
Protein SequenceSynthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
Molecular Weight39 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ANX1, LPC1

Similar Products

  • ANXA1 Antibody [orb241487]

    ELISA,  IF,  IP,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • Annexin A1/ANXA1 Rabbit Polyclonal Antibody [orb215882]

    IHC,  WB

    Human, Monkey, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Annexin I rabbit pAb Antibody [orb768587]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • ANXA1 Antibody [orb1274548]

    IF,  IHC,  KO/KD Validated,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • Annexin A1 Rabbit Polyclonal Antibody [orb10094]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ANXA1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

ANXA1 Rabbit Polyclonal Antibody

Sample Tissue: Human ACHN, Antibody Dilution: 1.0 ug/ml.

ANXA1 Rabbit Polyclonal Antibody

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

ANXA1 Rabbit Polyclonal Antibody

Positive control (+): A549 (N03), Negative control (-): RPMI-8226 (N12), Antibody concentration: 0.5 ug/ml.

ANXA1 Rabbit Polyclonal Antibody

Human Intestine

ANXA1 Rabbit Polyclonal Antibody

WB Suggested Anti-ANXA1 Antibody, Positive Control: Lane 1: 20 ug mouse fibroblast lysates, Primary Antibody Dilution: 1:600, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:2000.

ANXA1 Rabbit Polyclonal Antibody

WB Suggested Anti-ANXA1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000691

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ANXA1 Rabbit Polyclonal Antibody (orb576008)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry