Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ANXA4 Rabbit Polyclonal Antibody

SKU: orb576071

Description

ANXA4 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ANXA4. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA4. This antibody reacts with Human, Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ANXA4
TargetANXA4
Protein SequenceSynthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Molecular Weight36 kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-274

Similar Products

  • Annexin-4/ANXA4 Rabbit Polyclonal Antibody [orb1147794]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Annexin IV/ANXA4 Rabbit Polyclonal Antibody [orb18546]

    FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Annexin IV/ANXA4 Rabbit Polyclonal Antibody [orb106567]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ANXA4 rabbit pAb Antibody [orb773771]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • ANXA4 Rabbit Polyclonal Antibody [orb624737]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ANXA4 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein can be modified by acetylation and phosphorylation.

ANXA4 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

ANXA4 Rabbit Polyclonal Antibody

Positive control (+): Human stomach (ST), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

ANXA4 Rabbit Polyclonal Antibody

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.

ANXA4 Rabbit Polyclonal Antibody

Human Intestine

ANXA4 Rabbit Polyclonal Antibody

WB Suggested Anti-ANXA4 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001144

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ANXA4 Rabbit Polyclonal Antibody (orb576071)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry