Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

APOE Rabbit Polyclonal Antibody

SKU: orb333723

Description

APOE Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting APOE. It is suitable for IHC, WB and is reactive with human, mouse samples. Predicted reactivity includes Rat, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityRat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
TargetAPOE
Protein SequenceSynthetic peptide located within the following region: LMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVC
Molecular Weight36 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE antibody, Anti-APOE_HUMAN antibody, Anti-APOEA antibody, Anti-Apolipoprotein E antibody, Anti-Apolipoprotein E3 antibody, Anti-ApolipoproteinE antibody, Anti-Apoprotein antibody, Anti-LDLCQ5 antibody, Anti-LPG antibody

Similar Products

  • APOE Rabbit Polyclonal Antibody [orb333722]

    IHC,  WB

    Human

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Apolipoprotein E3 Rabbit Polyclonal Antibody [orb4523]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Apolipoprotein E Rabbit Polyclonal Antibody [orb339614]

    IHC-P,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Apolipoprotein E/APOE Rabbit Polyclonal Antibody [orb371720]

    ICC,  IF,  IHC,  WB

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Apolipoprotein E/APOE Rabbit Polyclonal Antibody [orb251510]

    ELISA,  FC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

APOE Rabbit Polyclonal Antibody

Sample Type: 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

APOE Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

APOE Rabbit Polyclonal Antibody

APOE antibody - N-terminal region (orb333723) validated by WB using 721_B cell lysate at 1.0 ug/ml. There is BioGPS gene expression data showing that APOE is expressed in 721_B.

APOE Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000032

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

APOE Rabbit Polyclonal Antibody (orb333723)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry