APRT Rabbit Polyclonal Antibody

SKU: orb583987

Description

APRT Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of APRT. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human APRT. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APRT
• Target: APRT
• Protein Sequence: Synthetic peptide located within the following region: ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK
• Molecular Weight: 20kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AMP, APRTD

Rabbit Anti-APRT Antibody, Catalog Number: orb583987, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-APRT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. APRT is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Quick Database Links

Gene Symbol

APRT

UniProt

P07741

RefSeq (Protein):NP_000476