Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ARL13B Rabbit Polyclonal Antibody

SKU: orb330698

Description

ARL13B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ARL13B. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human ARL13B. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARL13B
TargetARL13B
Protein SequenceSynthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
Molecular Weight48 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ARL2L1 antibody, anti DKFZp686E2075 antibody, anti DKFZp686L2472 antibody, anti DKFZp686M2074 antibody, anti DKFZp761H079 antibody, anti MGC120611 antibody, anti MGC120612 antibody, anti JBTS8 antibody

Similar Products

  • ARL13B Rabbit Polyclonal Antibody [orb1290028]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ARL13B Rabbit Polyclonal Antibody [orb420033]

    IHC-P,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ARL13B Rabbit Polyclonal Antibody [orb624852]

    ELISA,  IF,  IHC,  IP,  WB

    Canine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ARL13B Rabbit Polyclonal Antibody [orb559003]

    WB

    Human

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ARL13B Rabbit Polyclonal Antibody [orb666059]

    IF,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ARL13B Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The 49 kDa peptide is also present in 37 kDa isoforms. The protein may be modified by lipidation and/or sumoylation.

ARL13B Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

ARL13B Rabbit Polyclonal Antibody

Positive control (+): Lung tumor (T-LU), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

ARL13B Rabbit Polyclonal Antibody

WB Suggested Anti-ARL13B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_659433

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ARL13B Rabbit Polyclonal Antibody (orb330698)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry