Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ARRB2 Rabbit Polyclonal Antibody

SKU: orb330527

Description

ARRB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ARRB2. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human ARRB2. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ARRB2
TargetARRB2
Protein SequenceSynthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
Molecular Weight46kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ARB2 antibody, anti ARR2 antibody, anti DKFZp686L0365 antibody, anti BARR2 antibody

Similar Products

  • Beta arrestin 2 Rabbit Polyclonal Antibody [orb10139]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Guinea pig, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Beta Arrestin 2/ARRB2 Rabbit Polyclonal Antibody [orb11647]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • ARRB2 Rabbit Polyclonal Antibody [orb625115]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • ARRB2 Antibody [orb47855]

    ELISA,  IF,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Beta-arrestin 2 Rabbit Polyclonal Antibody [orb526755]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ARRB2 Rabbit Polyclonal Antibody

Human Skin

ARRB2 Rabbit Polyclonal Antibody

Sample Type: HepG2 cell lysate, Antibody concentration: 1.0 ug/ml, Gel concentration: 12%. ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2.

ARRB2 Rabbit Polyclonal Antibody

Sample Type: Lane 1: 20 ug mouse left ventricle heart lysate Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:5000 Color/Signal Descriptions: ARRB2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_945355

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ARRB2 Rabbit Polyclonal Antibody (orb330527)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry