ATP5F1B Rabbit Polyclonal Antibody

SKU: orb580321

Description

ATP5F1B Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ATP5F1B. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B. This antibody reacts with Human, Mouse, Rat samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rabbit, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATP5B
• Target: ATP5F1B
• Protein Sequence: Synthetic peptide located within the following region: PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
• Molecular Weight: 57 kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ATP5B, ATPMB, ATPSB, HEL-S-271

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2.5 ug/ml of the antibody was used in this experiment.

ATP5B antibody - N-terminal region (orb580321) validated by WB using HepG2 cell lysate at 1.25 ug/ml.

ATP5B antibody - N-terminal region (orb580321) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Human Muscle

Quick Database Links

Gene Symbol

ATP5F1B

UniProt

P06576

RefSeq (Protein):NP_001677