BRD7 Rabbit Polyclonal Antibody

SKU: orb576935

Description

BRD7 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of BRD7. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human BRD7. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BRD7
• Target: BRD7
• Protein Sequence: Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV
• Molecular Weight: 74kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BP75, NAG4, CELTIX1

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat.

Rabbit Anti-BRD7 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-BRD7 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

BRD7

UniProt

Q9NPI1

RefSeq (Protein):NP_037395