CA13 Rabbit Polyclonal Antibody

SKU: orb585954

Description

CA13 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting CA13. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: CA13
• Protein Sequence: Synthetic peptide located within the following region: HWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGH
• Molecular Weight: 29kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CAXIII

WB Suggested Anti-CA13 Antibody, Titration: 1.0 ug/ml, Positive Control: THP-1 Whole Cell.

Quick Database Links

Gene Symbol

CA13

UniProt

Q8N1Q1

RefSeq (Protein):NP_940986