CAPN1 Rabbit Polyclonal Antibody

SKU: orb331113

Description

CAPN1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CAPN1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human CAPN1. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAPN1
• Target: CAPN1
• Protein Sequence: Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE
• Molecular Weight: 82kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CANP antibody, anti CANP1 antibody, anti CANPL1 antibody, anti muCANP antibody, anti muCL antibody

CAPN1 antibody - middle region (orb331113) validated by WB using HT1080 cell lysate at 1 ug/ml.

Lanes: 1. 20 ug Jurkat cell lysate, 2. 20 ug Hut-78 cell lysate, 3. 20 ug K562 cell lysate, 4. 20 ug Raj cell lysate, 5. 20 ug U937 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: CAPN1.

Primary dilution: 1 ug/ml, Secondary dilution: 1:2000, Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells.

Rabbit Anti-CAPN1 Antibody, Catalog Number: orb331113, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Quick Database Links

Gene Symbol

CAPN1

UniProt

P07384

RefSeq (Protein):NP_005177