CBFA2T3 Rabbit Polyclonal Antibody

SKU: orb324761

Description

CBFA2T3 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of CBFA2T3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T3. This antibody reacts with Human samples and is predicted to react with Human. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T3
• Target: CBFA2T3
• Protein Sequence: Synthetic peptide located within the following region: MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP
• Molecular Weight: 60kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ETO2 antibody, anti MTG16 antibody, anti MTGR2 antibody, anti ZMYND4 antibody

WB Suggested Anti-CBFA2T3 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, CBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

CBFA2T3

UniProt

O75107

RefSeq:BAA31276