CBX4 Rabbit Polyclonal Antibody

SKU: orb573544

Description

CBX4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CBX4. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human CBX4. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CBX4
• Target: CBX4
• Protein Sequence: Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
• Molecular Weight: 61kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PC2, NBP16

Rabbit Anti-CBX 4 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CBX4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate, CBX4 is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

CBX4

UniProt

O00257

RefSeq (Protein):NP_003646