Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CCND1 Rabbit Polyclonal Antibody

SKU: orb574627

Description

CCND1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CCND1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human CCND1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CCND1
TargetCCND1
Protein SequenceSynthetic peptide located within the following region: KCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTA
Molecular Weight34 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

BCL1, PRAD1, U21B31, D11S287E

Similar Products

  • Cyclin D1 Rabbit Polyclonal Antibody [orb10496]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Cyclin D1 Rabbit Polyclonal Antibody [orb500813]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Cyclin D1 rabbit pAb Antibody [orb764956]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Porcine, Rat

    Polyclonal

    Unconjugated

  • Cyclin D1 Rabbit Polyclonal Antibody [orb77046]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Cyclin D1 Rabbit pAb Antibody [orb763762]

    IHC,  WB

    Mouse, Rat

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CCND1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

CCND1 Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

CCND1 Rabbit Polyclonal Antibody

Testis

CCND1 Rabbit Polyclonal Antibody

WB Suggested Anti-CCND1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Liver.

CCND1 Rabbit Polyclonal Antibody

WB Suggested Anti-CCND1 antibody Titration: 1 ug/ml, Sample Type: Human SH-SY5Y.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_444284

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CCND1 Rabbit Polyclonal Antibody (orb574627)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry