Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CD4 Rabbit Polyclonal Antibody

SKU: orb331017

Description

CD4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CD4. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human CD4. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CD4
TargetCD4
Protein SequenceSynthetic peptide located within the following region: VLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHR
Molecular Weight48kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-CD 4 antibody, Anti-CD4 (L3T4) antibody, Anti-CD4 antibody, Anti-CD4 antigen (p55) antibody, Anti-CD4 antigen antibody, Anti-CD4 molecule antibody, Anti-CD4 receptor antibody, Anti-CD4+ Lymphocyte deficiency, included antibody, Anti-CD4_HUMAN antibody, Anti-CD4mut antibody, Anti-L3T4 antibody, Anti-Leu3 antibody, Anti-Ly-4 antibody, Anti-Lymphocyte antigen CD4 antibody, Anti-MGC165891 antibody, Anti-OTTHUMP00000238897 antibody, Anti-p55 antibody, Anti-T cell antigen T4 antibody, Anti-T cell antigen T4/LEU3 antibody, Anti-T cell differentiation antigen L3T4 antibody, Anti-T cell OKT4 deficiency, included antibody, Anti-T cell surface antigen T4/Leu 3 antibody, Anti-T cell surface antigen T4/Leu3 antibody, Anti-T cell surface glycoprotein CD4 antibody, Anti-T-cell surface antigen T4/Leu-3 antibody, Anti-T-cell surface glycoprotein CD4 antibody, Anti-W3/25 antibody, Anti-W3/25 antigen antibody

Similar Products

  • CD4 Rabbit Polyclonal Antibody [orb4830]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CD4 Rabbit Polyclonal Antibody [orb182470]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Guinea pig, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • CD4 Rabbit Polyclonal Antibody [orb312176]

    IF,  IHC-Fr,  IHC-P,  WB

    Human, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CD4 Antibody [orb1261848]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CD4 rabbit pAb Antibody [orb764784]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CD4 Rabbit Polyclonal Antibody

WB Suggested Anti-CD4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000607

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CD4 Rabbit Polyclonal Antibody (orb331017)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry