CD63 Antibody

SKU: orb11597

Description

CD63 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of the members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. These proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: IF, IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:500-1:5,000, IF:1:25-1:250, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli. Antigen Sequence: MENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCI
• Target: Lysosome-associated membrane glycoprotein 3
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CD63 antigen, CD63 antigen (melanoma 1 antigen), granulophysin, LAMP-3, lysosomal-associated membrane protein 3, lysosome-associated membrane glycoprotein 3, ME491, melanoma-associated antigen, melanoma 1 antigen, melanoma-associated antigen ME491, MLA1, ocular melanoma-associated antigen, OMA81H, tetraspanin-30, TSPAN30 antibody.

Anti-CD63 Ab at 1/2,500 dilution; lysate at 50 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.

IHC of mouse spleen using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

Immunofluorescence – anti-CD63 Ab in Hepa1-6 cells at 1/50 dilution; cells were fixed with 4% of PFA.

IHC of human pancreas using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

Anti-CD63 Ab at 1/2,500 dilution; lysate at 50 µg per lane; Rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.

IHC of human cervix using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

Immunofluorescence – anti-CD63 Ab in Hepa1-6 cells at 1/50 dilution; cells were fixed with 4% of PFA.

IHC of rat eye using anti-CD63 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD63 Ab at 1:500/DAB detection.

Quick Database Links

Gene Symbol

Lysosome-associated membrane glycoprotein 3

Liu, Dishiwen et al. Cardiac Fibroblasts Promote Ferroptosis in Atrial Fibrillation by Secreting Exo-miR-23a-3p Targeting SLC7A11 Oxid Med Cell Longev, 2022, 3961495 (2022)

PubMed: 35677105