CD9 Rabbit Polyclonal Antibody

SKU: orb331123

Description

CD9 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CD9. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human CD9. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD9
• Target: CD9
• Protein Sequence: Synthetic peptide located within the following region: KYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
• Molecular Weight: 25 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 5H9 antibody, anti BA2 antibody, anti BTCC-1 antibody, anti DRAP-27 antibody, anti GIG2 antibody, anti MIC3 antibody, anti MRP-1 antibody, anti P24 antibody, anti TSPAN29 antibody, anti TSPAN-29 antibody

25 ug of THP-1 whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.

CD9 antibody - N-terminal region (orb331123) validated by WB using Fetal Heart Lysate at 1.0 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: mouse fibroblast lusate (10 ug) Primary dilution: 1:2000 (1% BSA) Secondary dilution: 1:2000 (5% milk).

Quick Database Links

Gene Symbol

CD9

UniProt

P21926

RefSeq (Protein):NP_001760