CDT1 Rabbit Polyclonal Antibody

SKU: orb325266

Description

CDT1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CDT1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human CDT1. This antibody reacts with Human, Mouse, Rat samples and is predicted to react with Bovine, Canine, Porcine, Rabbit, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Predicted Reactivity: Bovine, Canine, Porcine, Rabbit, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CDT1
• Target: CDT1
• Protein Sequence: Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ
• Molecular Weight: 60kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DUP antibody, anti RIS2 antibody

HC Suggested Anti-CDT1 antibody, Titration:2 ug/mL, Positive Control:Mouse brain stem cells.

Sample Type: 3. rat brain extract (80 ug), Primary Antibody Dilution: 2 ug/mL, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000.

WB Suggested Anti-CDT1 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

CDT1

UniProt

Q9H211

RefSeq (Protein):NP_112190