Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CEMIP Rabbit Polyclonal Antibody

SKU: orb325021

Description

CEMIP Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CEMIP. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human KIAA1199. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KIAA1199
TargetCEMIP
Protein SequenceSynthetic peptide located within the following region: PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLD
Molecular Weight153 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti TMEM2L antibody, anti CCSP1 antibody

Similar Products

  • CEMIP Rabbit Polyclonal Antibody [orb628245]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • KIAA1199 Rabbit Polyclonal Antibody [orb2292]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CEMIP Rabbit Polyclonal Antibody [orb666259]

    IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • KIAA1199 Rabbit Polyclonal Antibody [orb526642]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • KIAA1199 Rabbit Polyclonal Antibody (HRP) [orb467861]

    IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CEMIP Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 153 kDa is present as well as an isoform at 110 kDa and possibly a 3rd at 88 kDa.

CEMIP Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3, Antibody Dilution: 1.0 ug/mL.

CEMIP Rabbit Polyclonal Antibody

WB Suggested Anti-KIAA1199 Antibody Titration: 0.2-1 ug/mL, Positive Control: COLO205 cell lysate, KIAA1199 is supported by BioGPS gene expression data to be expressed in COLO205.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_061159

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CEMIP Rabbit Polyclonal Antibody (orb325021)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry