CNOT9 Rabbit Polyclonal Antibody

SKU: orb586451

Description

CNOT9 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CNOT9. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human RQCD1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RQCD1
• Target: CNOT9
• Protein Sequence: Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK
• Molecular Weight: 34kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RCD1, CAF40, CT129, RCD-1, RQCD1

Sample Type: 721_B Whole cell lysates, Antibody dilution: 1.0 ug/ml. RQCD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Quick Database Links

Gene Symbol

CNOT9

UniProt

Q92600

RefSeq (Protein):NP_005435