Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CNP Rabbit Polyclonal Antibody

SKU: orb574864

Description

CNP Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of CNP. It is suitable for IP, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human CNP. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

Tested ApplicationsIP, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Porcine, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CNP
TargetCNP
Protein SequenceSynthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
Molecular Weight45kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CNP1, HLD20

Similar Products

  • CNPase/CNP Rabbit Polyclonal Antibody [orb1291685]

    ELISA,  FC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CNPase Rabbit Polyclonal Antibody [orb10429]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Human, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GPX1 Rabbit Polyclonal Antibody [orb1728187]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody [orb319486]

    ELISA,  IHC,  WB

    Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    Unconjugated

  • CNP Rabbit Polyclonal Antibody [orb574863]

    IHC,  WB

    Canine, Equine, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CNP Rabbit Polyclonal Antibody

Amount and Sample Type: 500 ug mouse brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: CNP, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody dilution: 1:5000, Gene Name: CNP.

CNP Rabbit Polyclonal Antibody

IP Suggested Anti-CNP Antibody, Positive Control: NT2 CELL/BRAIN TISSUE.

CNP Rabbit Polyclonal Antibody

Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Rat brain extract (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000, Gene Name: CN.

CNP Rabbit Polyclonal Antibody

Rabbit Anti-CNP antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

CNP Rabbit Polyclonal Antibody

WB Suggested Anti-CNP Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate, CNP is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_149124

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IP
Immunoprecipitation
View Protocol

CNP Rabbit Polyclonal Antibody (orb574864)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry