CRBN Antibody

SKU: orb583355

Description

CRBN Antibody is an unconjugated, affinity purified antibody for the detection of CRBN. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human CRBN. This antibody reacts with Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CRBN
• Target: CRBN
• Protein Sequence: Synthetic peptide located within the following region: GIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLE
• Molecular Weight: 51 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MRT2, MRT2A

Quick Database Links

Gene Symbol

CRBN

UniProt

Q96SW2

RefSeq (Protein):NP_057386