CSH1 Rabbit Polyclonal Antibody

SKU: orb577543

Description

CSH1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of CSH1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human CSH1. This antibody reacts with Human samples and is predicted to react with Canine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CSH1
• Target: CSH1
• Protein Sequence: Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
• Molecular Weight: 24kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PL, CSA, CS-1, CSMT, GHB3, hCS-1, hCS-A

Rabbit Anti-CSH1 Antibody, Paraffin Embedded Tissue: Human Stomach, Cellular Data: Epithelial cells of fundic gland, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-CSH1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

CSH1

UniProt

P01243

RefSeq (Protein):NP_001308