Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CTDSPL Rabbit Polyclonal Antibody

SKU: orb330230

Description

CTDSPL Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CTDSPL. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human CTDSPL. This antibody reacts with Human samples and is predicted to react with Mouse, Porcine, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityMouse, Porcine, Rat, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CTDSPL
TargetCTDSPL
Protein SequenceSynthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
Molecular Weight30kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti C3orf8 antibody, anti HYA22 antibody, anti PSR1 antibody, anti SCP3 antibody, anti RBSP3 antibody

Similar Products

  • CTDSPL Rabbit Polyclonal Antibody [orb6921]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • CTDSPL Rabbit Polyclonal Antibody [orb2404]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • CTDSPL Rabbit Polyclonal Antibody (HRP) [orb467756]

    IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    HRP

  • CTDSPL Rabbit Polyclonal Antibody (Biotin) [orb458209]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

  • CTDSPL Rabbit Polyclonal Antibody (Cy5) [orb880096]

    FC,  IF

    Bovine, Equine, Gallus, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Cy5

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

CTDSPL Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

CTDSPL Rabbit Polyclonal Antibody

Rabbit Anti-CTDSPL Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

CTDSPL Rabbit Polyclonal Antibody

WB Suggested Anti-CTDSPL Antibody Titration: 0.2-1 ug/mL, Positive Control: DLD1 cell lysate, CTDSPL is strongly supported by BioGPS gene expression data to be expressed in Human DLD1 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005799

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CTDSPL Rabbit Polyclonal Antibody (orb330230)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry