Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Dct Rabbit Polyclonal Antibody

SKU: orb579402

Description

Dct Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Dct. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Mouse, Zebrafish samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

Tested ApplicationsIHC, WB
ReactivityMouse, Zebrafish
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetDct
Protein SequenceSynthetic peptide located within the following region: QHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFS
Molecular Weight59 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DT, TR, TRP, Tyr, slt, TRP2, Tyrp, TRP-2, Tyrp2, slaty, Tyrp-2

Similar Products

  • DCT/Dopachrome Tautomerase Antibody [orb1538842]

    ELISA,  IF,  IHC,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • TRP2 Rabbit Polyclonal Antibody [orb11521]

    IF,  IHC-Fr,  IHC-P

    Canine, Feline, Mouse, Porcine, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • DCT Rabbit Polyclonal Antibody [orb626285]

    ELISA,  IHC,  IP,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • DCT Antibody [orb519652]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • TRP2 Rabbit Polyclonal Antibody [orb213841]

    IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Dct Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Dct Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Dct Rabbit Polyclonal Antibody

Sample Type: Zebrafish embryo section, Primary Antibody Dilution: 1:50, Secondary Antibody: Anti-rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: DCT, Gene Name: Dct.

Dct Rabbit Polyclonal Antibody

WB Suggested Anti-Dct Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Mouse Heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_034154

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Dct Rabbit Polyclonal Antibody (orb579402)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry