DLG4 Rabbit Polyclonal Antibody

SKU: orb581300

Description

DLG4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of DLG4. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human DLG4. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DLG4
• Target: DLG4
• Protein Sequence: Synthetic peptide located within the following region: AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS
• Molecular Weight: 85kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MRD62, PSD95, SAP90, SAP-90

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

WB Suggested Anti-DLG4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate.

Quick Database Links

Gene Symbol

DLG4

UniProt

P78352

RefSeq (Protein):NP_001356