DNER Rabbit Polyclonal Antibody

SKU: orb330621

Description

DNER Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of DNER. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human DNER. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DNER
• Target: DNER
• Protein Sequence: Synthetic peptide located within the following region: DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP
• Molecular Weight: 50kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti UNQ26 antibody, anti bet antibody

WB Suggested Anti-DNER Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

DNER

UniProt

Q8NFT8

RefSeq:AAH24766