DUSP8 Rabbit Polyclonal Antibody

SKU: orb581551

Description

DUSP8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of DUSP8. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human DUSP8. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DUSP8
• Target: DUSP8
• Protein Sequence: Synthetic peptide located within the following region: PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP
• Molecular Weight: 66 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HB5, HVH8, HVH-5, C11orf81

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-DUSP8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: Transfected 293T.

Quick Database Links

Gene Symbol

DUSP8

UniProt

Q13202

RefSeq (Protein):NP_004411