EBF1 Rabbit Polyclonal Antibody

SKU: orb577182

Description

EBF1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EBF1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards (50ug) human EBF1.. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards (50ug) human EBF1.
• Target: EBF1
• Protein Sequence: LPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNS
• Molecular Weight: 64 kDa
• Purity: Affinity Purified
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EBF, COE1, OLF1, O/E-1

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Immunohistochemistry with Thymus tissue at an antibody concentration of 5 ug/ml using anti-EBF1 antibody (orb577182).

WB Suggested Anti-EBF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.

Quick Database Links

Gene Symbol

EBF1

UniProt

Q9UH73

Lin Rao, Liping Cai, Lusheng Huang, Single-cell dynamics of liver development in postnatal pigs Sci Bull., 2095-9273 (2023)

PubMed: 37783617