Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

EED Rabbit Polyclonal Antibody

SKU: orb329845

Description

EED Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EED. It is suitable for ICC, IF, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human EED. This antibody reacts with Human, Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsICC, IF, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EED
TargetEED
Protein SequenceSynthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
Molecular Weight50kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HEED antibody, anti WAIT1 antibody

Similar Products

  • EED Rabbit Polyclonal Antibody [orb329980]

    WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • EED antibody [orb73985]

    IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • EED Rabbit Polyclonal Antibody [orb1152353]

    ELISA,  FC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • EED Rabbit Polyclonal Antibody [orb666552]

    IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • EED Antibody [orb1239847]

    ELISA,  IF,  WB

    Bovine, Gallus

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

EED Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

EED Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

EED Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

EED Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

EED Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

EED Rabbit Polyclonal Antibody

Sample Type: Human Fetal Stomach, Antibody Dilution: 1.0 ug/mL.

EED Rabbit Polyclonal Antibody

Sample Type: Rat Brain lysate, Dilution: 1:500.

EED Rabbit Polyclonal Antibody

WB Suggested Anti-EED Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:2500, Positive Control: OVCAR-3 cell lysate, EED is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003788

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IF
Immunofluorescence
View Protocol
ICC
Immunocytochemistry
View Protocol

EED Rabbit Polyclonal Antibody (orb329845)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry