Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Egr1 Rabbit Polyclonal Antibody

SKU: orb576117

Description

Egr1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Egr1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Frog, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityFrog, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetEgr1
Protein SequenceSynthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

NG, TI, NGF, Zen, egr, Egr-, Krox, NGF1, TIS8, Zenk, Zfp-, ETR10, Egr-1, Krox-, NGFIA, Zfp-6, Zif26, ETR103, Krox-1, Krox24, NGF1-A, NGFI-A, Zif268, Krox-24, A530045N19Rik

Similar Products

  • Egr1 Rabbit Polyclonal Antibody [orb10586]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • EGR1 Rabbit Polyclonal Antibody [orb574097]

    IHC,  WB

    Bovine, Equine, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • EGR1 Rabbit Polyclonal Antibody [orb1145818]

    ELISA,  FC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • TOE1 Rabbit Polyclonal Antibody [orb1402143]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • EGR1 Rabbit Polyclonal Antibody [orb576118]

    IHC,  WB

    Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep

    Frog, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Egr1 Rabbit Polyclonal Antibody

Sample Type: Frog brain, Primary Antibody Dilution: 1:500, Secondary Antibody: Biotinylated goat anti-rabbit, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: Black: EGR1, Gene Name: Egr1 a.

Egr1 Rabbit Polyclonal Antibody

Sample Type: Frog brain, Primary Antibody Dilution: 1:500, Secondary Antibody: Biotinylated goat anti-rabbit, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: Black: EGR1, Gene Name: Egr1 a.

Egr1 Rabbit Polyclonal Antibody

WB Suggested Anti-Egr1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_031939

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Egr1 Rabbit Polyclonal Antibody (orb576117)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry