Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

EGR2 Rabbit Polyclonal Antibody

SKU: orb333122

Description

EGR2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EGR2. It is suitable for IHC-P, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2. This antibody reacts with Human, Mouse, Rat samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

Tested ApplicationsIHC-P, WB
ReactivityHuman, Mouse, Rat
Predicted ReactivityBovine, Canine, Equine, Porcine, Rabbit

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human EGR2
TargetEGR2
Protein SequenceSynthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
Molecular Weight50kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CMT1D antibody, anti CMT4E antibody, anti DKFZp686J1957 antibody, anti FLJ14547 antibody, anti KROX20 antibody, anti AT591 antibody

Similar Products

  • Krox-20 Rabbit Polyclonal Antibody [orb381897]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • EGR2 Rabbit Polyclonal Antibody [orb2377]

    IF,  IHC-Fr,  IHC-P,  WB

    Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • EGR Rabbit Polyclonal Antibody [orb213880]

    IF,  IHC,  WB

    Bovine, Gallus, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • EGR2 Antibody [orb52519]

    ELISA,  IF,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • EGR2 Rabbit Polyclonal Antibody [orb137949]

    ICC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

EGR2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Small Intestine, Antibody dilution: 1 ug/ml.

EGR2 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

EGR2 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

EGR2 Rabbit Polyclonal Antibody

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

EGR2 Rabbit Polyclonal Antibody

Human Intestine

EGR2 Rabbit Polyclonal Antibody

Rabbit Anti-EGR2 Antibody, Paraffin Embedded Tissue: Human bronchiole epithelium, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

EGR2 Rabbit Polyclonal Antibody

WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Lung.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000390

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol

EGR2 Rabbit Polyclonal Antibody (orb333122)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry