EPX Rabbit Polyclonal Antibody

SKU: orb578198

Description

EPX Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EPX. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human EPX. This antibody reacts with Human samples and is predicted to react with Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EPX
• Target: EPX
• Protein Sequence: Synthetic peptide located within the following region: LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP
• Molecular Weight: 81kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EPO, EPP, EPXD, EPX-PEN

Sample Type: MCF7, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

WB Suggested Anti-EPX Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate.

Quick Database Links

Gene Symbol

EPX

UniProt

P11678

RefSeq (Protein):NP_000493