Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ERBB2 Antibody

SKU: orb334988

Description

Goat polyclonal antibody to ERBB2. This protein is a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases containing a single transmembrane domain and has an approximate molecular weight of 185 kDa. ERBB2 contains no ligand binding domain and interacts with other EGF receptor family members to form a heterodimer, stabilize ligand binding, and enhance kinase-mediated downstream signalling. It has been shown to be involved in embryonic development and cancer progression.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC-Fr, IHC-P, WB
Dilution RangeWB:1:500-1:5,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
ReactivityBovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli. Antigen Sequence: MPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
TargetErb-b2 receptor tyrosine kinase
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration1 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CD340, erb-b2 receptor tyrosine kinase 2, HER2, HER-2, HER-2/neu, MLN 19, NEU, NGL and TKR1 antibody.

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

ERBB2 Antibody

Western blot analysis of staining of SKOV using ERBB2 antibody

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC-P
Immunohistochemistry Paraffin
View Protocol
IHC-Fr
Immunohistochemistry Frozen
View Protocol

ERBB2 Antibody (orb334988)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 280.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

Instock
In stock
Bulk Enquiry