Exd Rabbit Polyclonal Antibody

SKU: orb325377

Description

Exd Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of exd. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Fruit fly. This antibody reacts with Drosophila samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Drosophila
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Fruit fly
• Target: exd
• Protein Sequence: Synthetic peptide located within the following region: EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA
• Molecular Weight: 42kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti Dmel_CG8933 antibody, anti CG8933 antibody, anti DExd antibody, anti Dm-EXD antibody, anti Dpbx antibody, anti EXD antibody, anti td48 antibody, anti unnamed antibody, anti anon-EST:fe1H3 antibody, anti Dmel\CG8933 antibody, anti Exd antibody, anti l(1)IV antibody, anti Pbx1 antibody

exd antibody - C-terminal region (orb325377) validated by WB using Drosophila EXD constructs at 1:1000.

Lanes: Lane 1: E. coli purified Exd (no tag), Lane 2: Cell free expressed Exd (His tag), Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: exd.

WB Suggested Anti-exd Antibody Titration: 5.0 ug/mL, Positive Control: Drosophila.

Quick Database Links

Gene Symbol

exd

UniProt

P40427

RefSeq (Protein):NP_727924