Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FAH Rabbit Polyclonal Antibody

SKU: orb578161
KO/KD
Validated
KO/KD Validated

Description

FAH Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FAH. It is suitable for IHC, KO/KD Validated, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human FAH. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, KO/KD Validated, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FAH
TargetFAH
Protein SequenceSynthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT
Molecular Weight46 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • FAH Rabbit Polyclonal Antibody [orb578162]

    IHC,  KO/KD Validated,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • FAA/FAH Rabbit Polyclonal Antibody [orb1152350]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • FAH Antibody [orb1260397]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • FAH Rabbit Polyclonal Antibody [orb24041]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • Rabbit FANCA Antibody [orb1527444]

    FC,  IP,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

FAH Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

FAH Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

FAH Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

FAH Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

FAH Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

FAH Rabbit Polyclonal Antibody

Positive control (+): Human lung (LU), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

FAH Rabbit Polyclonal Antibody

Immunohistochemistry with human kidney.

FAH Rabbit Polyclonal Antibody

Immunohistochemistry with human liver.

FAH Rabbit Polyclonal Antibody

Sample Type: Human Liver and Mouse FAH KO liver, Primary Dilution: 1:400.

FAH Rabbit Polyclonal Antibody

WB Suggested Anti-FAH Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000128

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

FAH Rabbit Polyclonal Antibody (orb578161)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry