Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FN1 Rabbit Polyclonal Antibody

SKU: orb330187

Description

FN1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FN1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human FN1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cardiovascular Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FN1
TargetFN1
Protein SequenceSynthetic peptide located within the following region: NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR
Molecular Weight76kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CIG antibody, anti DKFZp686F10164 antibody, anti DKFZp686H0342 antibody, anti DKFZp686I1370 antibody, anti DKFZp686O13149 antibody, anti FINC antibody, anti FN antibody, anti LETS antibody, anti MSF antibody, anti FNZ antibody, anti ED-B antibody, anti GFND antibody, anti GFND2 antibody

Similar Products

  • Fibronectin/FN1 Rabbit Polyclonal Antibody [orb10665]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Fibronectin/FN1 Rabbit Polyclonal Antibody [orb570334]

    ELISA,  FC,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • FN1 rabbit pAb Antibody [orb765230]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • Fibronectin/Ugl-Y3 Rabbit Polyclonal Antibody [orb221410]

    ICC,  IF,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Fibronectin/Ugl-Y3 Rabbit Polyclonal Antibody (FITC) [orb222081]

    ICC

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

FN1 Rabbit Polyclonal Antibody

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

FN1 Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/mL.

FN1 Rabbit Polyclonal Antibody

WB Suggested Anti-FN1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
RefSeqEAW70534

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

FN1 Rabbit Polyclonal Antibody (orb330187)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry