Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

FOXA1 Rabbit Polyclonal Antibody

SKU: orb574302
KO/KD
Validated
KO/KD Validated

Description

FOXA1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FOXA1. It is suitable for IHC, KO/KD Validated, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Guinea pig, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, KO/KD Validated, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Guinea pig, Rat, Yeast, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FOXA1
TargetFOXA1
Protein SequenceSynthetic peptide located within the following region: SFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASV
Molecular Weight49kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HNF3A, TCF3A

Similar Products

  • FOXA1 Rabbit Polyclonal Antibody [orb583752]

    WB

    Bovine, Canine, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • HNF-3α/β/γ (Acetyl Lys264/253/211) rabbit pAb Antibody [orb763976]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • HNF-3α/β/γ rabbit pAb Antibody [orb766929]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • FOXA1 Rabbit Polyclonal Antibody [orb402191]

    ELISA,  FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • FOXA1 Rabbit Polyclonal Antibody [orb627101]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

FOXA1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

FOXA1 Rabbit Polyclonal Antibody

Rabbit Anti-FOXA1 antibody, Catalog Number: orb574302, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclei in adipocytes but not in cardiomyocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

FOXA1 Rabbit Polyclonal Antibody

WB Suggested Anti-FOXA1 Antibody, Positive Control: Lane 1: 20 ug MCF7 cell lysates, Lane 2: 20 ug MCF7 cell lysates, Lane 3: 20 ug MCF7 cell lysate, s Lane 4: 20 ug MCF7 cell lysate, s Lane 5: 20 ug MCF7 with FoxA1 knockdown Lane 6: 20 ug MCF7 with FoxA1 knockdown, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000. FOXA1 is supported by BioGPS gene expression data to be expressed in MCF7.

FOXA1 Rabbit Polyclonal Antibody

WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

FOXA1 Rabbit Polyclonal Antibody

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

FOXA1 Rabbit Polyclonal Antibody

WB Suggested Anti-FOXA1 antibody Titration: 1 ug/ml, Sample Type: Human liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004487

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

FOXA1 Rabbit Polyclonal Antibody (orb574302)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry