Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GALM Rabbit Polyclonal Antibody

SKU: orb325762

Description

GALM Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GALM. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human GALM. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GALM
TargetGALM
Protein SequenceSynthetic peptide located within the following region: WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK
Molecular Weight38kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti BLOCK 25 antibody, anti IBD1 antibody, anti BLOCK25 antibody

Similar Products

  • GALM Antibody [orb239840]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GALM Rabbit Polyclonal Antibody [orb627218]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GALM rabbit pAb Antibody [orb772251]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • Mutarotase Rabbit Polyclonal Antibody [orb221518]

    WB

    Bovine, Canine, Equine, Human, Porcine, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • GALM Rabbit Polyclonal Antibody [orb157026]

    IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Human, Mouse, Porcine, Sheep

    Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

GALM Rabbit Polyclonal Antibody

GALM was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb325762 with 1:200 dilution. Western blot was performed using orb325762 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: GALM IP with orb325762 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

GALM Rabbit Polyclonal Antibody

WB Suggested Anti-GALM Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_620156

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GALM Rabbit Polyclonal Antibody (orb325762)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry