GATA6 Rabbit Polyclonal Antibody

SKU: orb573932

Description

GATA6 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GATA6. It is suitable for IF, IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human GATA6. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IF, IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GATA6
• Target: GATA6
• Protein Sequence: Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
• Molecular Weight: 60kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ASD9, AVSD5, PACHD

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.

Rabbit Anti-GATA6 Antibody, Paraffin Embedded Tissue: Human Colon, Antibody Concentration: 5 ug/ml.

The cells are human embryonic stem cell line H1 differentiated to HNF4 positive hepatic progenitor cells. The antibodies were used at a 1:250 dilution.

WB Suggested Anti-GATA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.

Quick Database Links

Gene Symbol

GATA6

UniProt

Q92908

RefSeq (Protein):NP_005248