Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GOT1 Rabbit Polyclonal Antibody

SKU: orb330539

Description

GOT1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of GOT1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GOT1
TargetGOT1
Protein SequenceSynthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
Molecular Weight46kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti GIG18 antibody, anti ASTQTL1 antibody

Similar Products

  • GOT1 Antibody [orb241515]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • Aspartate Aminotransferase/GOT1 Rabbit Polyclonal Antibody [orb745949]

    ELISA,  FC,  ICC,  IF,  IHC,  KO/KD Validated,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GOT1 Rabbit Polyclonal Antibody [orb330538]

    IHC,  WB

    Bovine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • GOT1 Antibody [orb1257305]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GOT1 Antibody [orb520331]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

GOT1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

GOT1 Rabbit Polyclonal Antibody

Sample Type: NCI-H226, Antibody dilution: 1.0 ug/ml. GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226.

GOT1 Rabbit Polyclonal Antibody

WB Suggested Anti-GOT1 Antibody Titration: 1.0 ug/ml, ELISA Titer: 1:1562500, Positive Control: NCI-H226 cell lysate, GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002070

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GOT1 Rabbit Polyclonal Antibody (orb330539)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry