Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GP1BA Rabbit Polyclonal Antibody

SKU: orb581343

Description

GP1BA Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GP1BA. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cardiovascular Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityCanine, Equine, Mouse, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA
TargetGP1BA
Protein SequenceSynthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
Molecular Weight72 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBPLT3, GPIbalpha, CD42b-alpha

Similar Products

  • GP1BA Rabbit Polyclonal Antibody [orb247044]

    ELISA,  IHC-P

    Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GP1BA Rabbit Polyclonal Antibody [orb6179]

    WB

    Human, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • CD42b rabbit pAb Antibody [orb766998]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

  • GP1BA Antibody [orb520944]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • GP1BA Rabbit Polyclonal Antibody [orb625605]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

GP1BA Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Two isoforms contain this peptide sequence, including the 72 kDa canonical isoform and a 69 kDa alternate isoform. Additionally the full length protein can be processed into two chains of ~70 kDa and ~54 kDa forms.

GP1BA Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

GP1BA Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.

GP1BA Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

GP1BA Rabbit Polyclonal Antibody

Positive control (+): A549 (N03), Negative control (-): RPMI-8226 (N12), Antibody concentration: 1 ug/ml.

GP1BA Rabbit Polyclonal Antibody

WB Suggested Anti-GP1BA Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000164

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GP1BA Rabbit Polyclonal Antibody (orb581343)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry