GPC3 Rabbit Polyclonal Antibody

SKU: orb576371

Description

GPC3 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of GPC3. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human GPC3. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPC3
• Target: GPC3
• Protein Sequence: Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
• Molecular Weight: 66 kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. GPC3 is shown in multiple isoforms and is also cleaved to a 36 kDa mature subunit.

Sample Tissue: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml.

Rabbit Anti-GPC3 antibody, Catalog Number: orb576371, Paraffin Embedded Tissue: Human Placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-GPC3 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

GPC3

UniProt

P51654

RefSeq (Protein):NP_004475