Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GPX4 Rabbit Polyclonal Antibody

SKU: orb330978

Description

GPX4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GPX4. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human GPX4. This antibody reacts with Human, Rat samples and is predicted to react with Bovine, Goat, Guinea pig, Mouse, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Goat, Guinea pig, Mouse, Yeast, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GPX4
TargetGPX4
Protein SequenceSynthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
Molecular Weight19 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti MCSP antibody, anti PHGPx antibody, anti snGPx antibody, anti snPHGPx antibody

Similar Products

  • GPX4 Rabbit Polyclonal Antibody [orb5346]

    WB

    Bovine, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GPX4/MCSP Antibody [orb1536231]

    ICC,  IF,  IHC,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GPX4 Rabbit Polyclonal Antibody [orb1100604]

    ELISA,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GPX4 Rabbit Polyclonal Antibody [orb627489]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GPX4 Antibody [orb51150]

    ELISA,  IF,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

GPX4 Rabbit Polyclonal Antibody

25 ug of the indicated Human cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Recognizes 19 kDa cytoplasmic form in these cell lines, mitochondrial form of 22 kDa appears absent in these samples.

GPX4 Rabbit Polyclonal Antibody

GPX4 antibody - middle region (orb330978) validated by WB using HepG2 cell lysate at 1.0 ug/ml. GPX4 is supported by BioGPS gene expression data to be expressed in HepG2.

GPX4 Rabbit Polyclonal Antibody

Immunohistochemistry with formalin-fixed, paraffin-embedded human Heart tissue at an antibody concentration of 5.0 ug/ml using anti-GPX4 antibody (orb330978).

GPX4 Rabbit Polyclonal Antibody

Immunohistochemistry with Rat Brain lysate tissue.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002076

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GPX4 Rabbit Polyclonal Antibody (orb330978)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry