Gria3 Rabbit Polyclonal Antibody

SKU: orb575347

Description

Gria3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Gria3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Rat Gria3. This antibody reacts with Mouse, Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Gria3
• Target: Gria3
• Protein Sequence: Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM
• Molecular Weight: 97kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GLUR3, GluA3, GluR-3, GluR-C, GluR-K3

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Type: Rat Stomach lysates, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

Gria3

UniProt

P19492

RefSeq (Protein):NP_116785