Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GSK3B Rabbit Polyclonal Antibody

SKU: orb330768

Description

GSK3B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GSK3B. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human GSK3B. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human GSK3B
TargetGSK3B
Protein SequenceSynthetic peptide located within the following region: AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF
Molecular Weight48kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • GSK-3 Beta Rabbit Polyclonal Antibody [orb10754]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-GSK-3 Beta (Ser9) Rabbit Polyclonal Antibody [orb10755]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GSK3 beta/GSK3B Rabbit Polyclonal Antibody [orb1290012]

    ELISA,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Phospho-GSK-3 Beta (Ser21) Rabbit Polyclonal Antibody [orb5357]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Guinea pig, Human, Porcine, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • GSK3β (phospho Ser9) Polyclonal Antibody [orb1415398]

    IF,  IHC-P,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

GSK3B Rabbit Polyclonal Antibody

Brain, cortex.

GSK3B Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

GSK3B Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

GSK3B Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. GSK3B is supported by BioGPS gene expression data to be expressed in HeLa.

GSK3B Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

GSK3B Rabbit Polyclonal Antibody

Rabbit Anti-GSK3B Antibody, Catalog Number: orb330768, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Nucleus, Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

GSK3B Rabbit Polyclonal Antibody

WB Suggested Anti-GSK3B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, GSK3B is supported by BioGPS gene expression data to be expressed in 721_B.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002084

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

GSK3B Rabbit Polyclonal Antibody (orb330768)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry