Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Hdac6 Rabbit Polyclonal Antibody

SKU: orb576809

Description

Hdac6 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Hdac6. It is suitable for ChIP, IHC, WB applications. The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsChIP, IHC, WB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6
TargetHdac6
Protein SequenceSynthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
Molecular Weight126kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Hd6, Sfc, Sfc6, mHDA, Hdac5, mHDA2

Similar Products

  • Hdac6 Rabbit Polyclonal Antibody [orb574130]

    IHC,  WB

    Guinea pig, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • HDAC6 rabbit pAb Antibody [orb765379]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

  • HDAC6 (phospho Ser22) rabbit pAb Antibody [orb767279]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

  • HDAC6 Rabbit Polyclonal Antibody [orb573804]

    ChIP,  IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • HDAC6 Antibody [orb1538511]

    ELISA,  IF,  IHC,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Hdac6 Rabbit Polyclonal Antibody

Chromatin Immunoprecipitation (ChIP) Using Hdac6 Antibody - C-terminal region (orb576809) and HCT116 Cells.

Hdac6 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Hdac6 Rabbit Polyclonal Antibody

Rabbit Anti-Hdac6 Antibody, Catalog Number: orb576809, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Hdac6 Rabbit Polyclonal Antibody

WB Suggested Anti-Hdac6 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Testis.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_034543

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol
ChIP
Chromatin Immunoprecipitation
View Protocol

Hdac6 Rabbit Polyclonal Antibody (orb576809)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry