Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HNRPA3 Rabbit Polyclonal Antibody

SKU: orb324945

Description

HNRPA3 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of HNRNPA3. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA3. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA3
TargetHNRNPA3
Protein SequenceSynthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
Molecular Weight42kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FBRNP antibody, anti HNRPA3 antibody, anti D10S102 antibody, anti 2610510D13Rik antibody

Similar Products

  • HNRPA3 Rabbit Polyclonal Antibody [orb324946]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • HnRNP A3 Rabbit Polyclonal Antibody [orb184070]

    ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

  • HNRNPA3 Rabbit Polyclonal Antibody [orb627758]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

  • Rabbit HNRNPA3 Antibody [orb1520387]

    IP,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

  • HNRNPA3 Rabbit Polyclonal Antibody [orb327417]

    WB

    Human

    Human

    Rabbit

    Polyclonal

    Unconjugated

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

HNRPA3 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

HNRPA3 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 0.625 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

HNRPA3 Rabbit Polyclonal Antibody

Positive control (+): HeLa Cell Lysate (HL), Negative control (-): Human Fetal Heart (HE), Antibody concentration: 3 ug/mL.

HNRPA3 Rabbit Polyclonal Antibody

Rabbit Anti-HNRPA3 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

HNRPA3 Rabbit Polyclonal Antibody

Rabbit Anti-HNRPA3 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

HNRPA3 Rabbit Polyclonal Antibody

WB Suggested Anti-HNRPA3 antibody Titration: 1 ug/mL, Sample Type: Human 721_B.

HNRPA3 Rabbit Polyclonal Antibody

WB Suggested Anti-HNRPA3 antibody Titration: 1 ug/mL, Sample Type: Human Daudi.

HNRPA3 Rabbit Polyclonal Antibody

WB Suggested Anti-HNRPA3 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, HNRNPA3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_919223

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HNRPA3 Rabbit Polyclonal Antibody (orb324945)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry